BAT5 (ABHD16A) Rabbit Polyclonal Antibody

CAT#: TA338460

Rabbit Polyclonal Anti-ABHD16A Antibody

Product Images

WB Suggested Anti-BAT5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABHD16Aantibody: synthetic peptide directed towards the N terminal of human BAT5. Synthetic peptide located within the following region: VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: abhydrolase domain containing 16A
• Database Link:
  NP_066983
  Entrez Gene 7920 Human
  UniProt ID O95870
• Background: A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. ABHD16Ais thought to be involved in some aspects of immunity.A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity.
• Synonyms: BAT5; D6S82E; NG26; PP199
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 75%

Reference Data

• Protein Families: Transmembrane