XYLT2 Rabbit Polyclonal Antibody

CAT#: TA338490

Rabbit Polyclonal Anti-XYLT2 Antibody

Product Images

WB Suggested Anti-XYLT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: xylosyltransferase 2
• Database Link:
  NP_071450
  Entrez Gene 64132 Human
  UniProt ID Q9H1B5
• Background: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteo
• Synonyms: PXYLT2; SOS; XT-II; XT2; xylT-II
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways