CLIC2 Rabbit Polyclonal Antibody

CAT#: TA338518

Rabbit Polyclonal Anti-CLIC2 Antibody

Product Images

WB Suggested Anti-CLIC2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLIC2 antibody: synthetic peptide directed towards the C terminal of human CLIC2. Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: chloride intracellular channel 2
• Database Link:
  NP_001280
  Entrez Gene 1193 Human
  UniProt ID O15247
• Background: This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein may play a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of X-linked mental retardation-32. [provided by RefSeq, Aug 2013]
• Synonyms: CLIC2b; MRXS32; XAP121
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other