P2X1 (P2RX1) Rabbit Polyclonal Antibody

CAT#: TA338532

Rabbit Polyclonal Anti-P2RX1 Antibody

Product Images

WB Suggested Anti-P2RX1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Human Pancreas

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RX1 antibody: synthetic peptide directed towards the middle region of human P2RX1. Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: purinergic receptor P2X 1
• Database Link:
  NP_002549
  Entrez Gene 5023 Human
  UniProt ID P51575
• Background: The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates synaptic transmission between neurons and from neurons to smooth muscle and may being responsible for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. This protein may also be involved in promoting apoptosis. [provided by RefSeq, Jun 2013]
• Synonyms: P2X1
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction