VDAC2 Rabbit Polyclonal Antibody

CAT#: TA338535

Rabbit Polyclonal Anti-VDAC2 Antibody

Product Images

Host: Rabbit; Target Name: VDAC2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-VDAC2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysateVDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: voltage dependent anion channel 2
• Database Link:
  NP_003366
  Entrez Gene 7417 Human
  UniProt ID P45880
• Background: This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Synonyms: POR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Goat: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease