TRPC6 Rabbit Polyclonal Antibody

CAT#: TA338540

Rabbit Polyclonal Anti-TRPC6 Antibody

Product Images

WB Suggested Anti-TRPC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

• 

  TRPC6 antibody - middle region validated by WB using pulmonary artery smooth muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: transient receptor potential cation channel subfamily C member 6
• Database Link:
  NP_004612
  Entrez Gene 89823 RatEntrez Gene 7225 Human
  UniProt ID Q9Y210
• Background: The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009]
• Synonyms: FSGS2; TRP6
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Yeast: 86%; Mouse: 85%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane