TRPC6 Rabbit Polyclonal Antibody

CAT#: TA338540

Rabbit Polyclonal Anti-TRPC6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TRPC6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 106 kDa
Gene Name transient receptor potential cation channel subfamily C member 6
Background The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009]
Synonyms FSGS2; TRP6
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Yeast: 86%; Mouse: 85%; Rat: 77%
Reference Data
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.