TNFAIP1 Rabbit Polyclonal Antibody

CAT#: TA338597

Rabbit Polyclonal Anti-Tnfaip1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TNFAIP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Tnfaip1 antibody is: synthetic peptide directed towards the C-terminal region of RAT Tnfaip1. Synthetic peptide located within the following region: LNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name TNF alpha induced protein 1
Background Tnfaip1 is a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in regulation of cytoskeleton structure. The BCR(BACURD2) E3 ubiquitin ligase complex mediates the ubiquitination of RHOA, leading to its degradation by the proteasome, thereby regulating the actin cytoskeleton and cell migration. Its interaction with RHOB may regulate apoptosis.
Synonyms B12; B61; BTBD34; EDP1; hBACURD2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.