KCNK10 Rabbit Polyclonal Antibody

CAT#: TA338599

Rabbit Polyclonal Anti-KCNK10 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KCNK10"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the C terminal of human KCNK10. Synthetic peptide located within the following region: QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name potassium two pore domain channel subfamily K member 10
Background The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Sep 2008]
Synonyms K2p10.1; PPP1R97; TREK-2; TREK2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.