NDST4 Rabbit Polyclonal Antibody

CAT#: TA338610

Rabbit Polyclonal Anti-NDST4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NDST4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the N terminal of human NDST4. Synthetic peptide located within the following region: EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 101 kDa
Gene Name N-deacetylase/N-sulfotransferase 4
Background NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity.
Synonyms N-HSST; N-HSST 4; NDST-4; NHSST4
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 90%
Reference Data
Protein Families Transmembrane
Protein Pathways Heparan sulfate biosynthesis, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.