TMEM106C Rabbit Polyclonal Antibody

CAT#: TA338645

Rabbit Polyclonal Anti-TMEM106C Antibody

Product Images

WB Suggested Anti-TMEM106C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM106C antibody: synthetic peptide directed towards the middle region of human TMEM106C. Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: transmembrane protein 106C
• Database Link:
  NP_076961
  Entrez Gene 79022 Human
  UniProt ID Q9BVX2
• Background: It belongs to TMEM106 family. The exact function of TMEM106C remains unknown.
• Synonyms: MGC5576; MGC111210
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 85%; Bovine: 85%; Yeast: 79%

Reference Data

• Protein Families: Transmembrane