TMEM106C Rabbit Polyclonal Antibody
Other products for "TMEM106C"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TMEM106C antibody: synthetic peptide directed towards the middle region of human TMEM106C. Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 28 kDa |
Gene Name | transmembrane protein 106C |
Database Link | |
Background | It belongs to TMEM106 family. The exact function of TMEM106C remains unknown. |
Synonyms | MGC5576; MGC111210 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 85%; Bovine: 85%; Yeast: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.