TRPV4 Rabbit Polyclonal Antibody

CAT#: TA338698

Rabbit Polyclonal Anti-TRPV4 Antibody

Product Images

WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: ACHN cell lysate

• 

  TRPV4 Rat Hippocampus We tested the antibodies in Immunohistochemistry studies. The dilutions for all the above primary antibodies were 1:500 and the same for the secondary antibody, Alexa Fluor 568-conjugated goat anti-rabbit antibodies (Invitrogen).

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: transient receptor potential cation channel subfamily V member 4
• Database Link:
  NP_671737
  Entrez Gene 66026 Rat
  UniProt ID Q9HBA0
• Background: This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]
• Synonyms: BCYM3; CMT2C; HMSN2C; OTRPC4; SMAL; SPSMA; SSQTL1; TRP12; VRL2; VROAC
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Dog: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane