KCNK15 Rabbit Polyclonal Antibody

CAT#: TA338709

Rabbit Polyclonal Anti-KCNK15 Antibody

Product Images

WB Suggested Anti-KCNK15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNK15 antibody: synthetic peptide directed towards the middle region of human KCNK15. Synthetic peptide located within the following region: ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: potassium two pore domain channel subfamily K member 15
• Database Link:
  NP_071753
  Entrez Gene 60598 Human
  UniProt ID Q9H427
• Background: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq, Jul 2008]
• Synonyms: dJ781B1.1; K2p15.1; KCNK11; KCNK14; KT3.3; TASK-5; TASK5
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 92%; Bovine: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane