CATSPER2 Rabbit Polyclonal Antibody

CAT#: TA338749

Rabbit Polyclonal Anti-CATSPER2 Antibody

Product Images

WB Suggested Anti-CATSPER2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

• 

  Host: Rabbit; Target Name: CATSPER2; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml CATSPER2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2. Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Database Link:
  NP_742094
  Entrez Gene 117155 Human
• Background: Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q15; the second copy of this gene is thought to be a pseudogene. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]
• Synonyms: cation channel; MGC33346; OTTHUMP00000066276; OTTHUMP00000066277; OTTHUMP00000066278; sperm-associated cation channel 2; sperm associated 2; sperm ion channel
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 92%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane