LGICZ1 (ZACN) Rabbit Polyclonal Antibody
Other products for "ZACN"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LGICZ1 antibody: synthetic peptide directed towards the N terminal of human LGICZ1. Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 46 kDa |
Gene Name | zinc activated ion channel |
Database Link | |
Background | LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AB223030.1, BC110597.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | L2; LGICZ; LGICZ1; ZAC; ZAC1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 86%; Bovine: 85% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.