CACNB1 Rabbit Polyclonal Antibody
Other products for "CACNB1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 58 kDa |
Gene Name | calcium voltage-gated channel auxiliary subunit beta 1 |
Database Link | |
Background | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Synonyms | CAB1; CACNLB1; CCHLB1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.