PIWIL4 Rabbit Polyclonal Antibody

CAT#: TA338845

Rabbit Polyclonal Anti-PIWIL4 Antibody

Product Images

WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96
• Gene Name: piwi like RNA-mediated gene silencing 4
• Database Link:
  NP_689644
  Entrez Gene 143689 Human
  UniProt ID Q7Z3Z4
• Background: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
• Synonyms: HIWI2; MIWI2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Dorso-ventral axis formation