AMDHD1 Rabbit Polyclonal Antibody

CAT#: TA338846

Rabbit Polyclonal Anti-AMDHD1 Antibody

Product Images

WB Suggested Anti-AMDHD1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AMDHD1 antibody: synthetic peptide directed towards the N terminal of human AMDHD1. Synthetic peptide located within the following region: AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: amidohydrolase domain containing 1
• Database Link:
  NP_689648
  Entrez Gene 144193 Human
  UniProt ID Q96NU7
• Background: The function of this protein remains unknown.
• Synonyms: HMFT1272
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Histidine metabolism, Metabolic pathways