WBP2NL Rabbit Polyclonal Antibody

CAT#: TA338888

Rabbit Polyclonal Anti-WBP2NL Antibody

Product Images

WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WBP2NL antibody: synthetic peptide directed towards the N terminal of human WBP2NL. Synthetic peptide located within the following region: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: WBP2 N-terminal like
• Database Link:
  NP_689826
  Entrez Gene 164684 Human
  UniProt ID Q6ICG8
• Background: WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
• Synonyms: GRAMD7; PAWP
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Dog: 85%; Guinea pig: 85%; Rabbit: 77%