SH3BGR Rabbit Polyclonal Antibody

CAT#: TA338902

Rabbit Polyclonal Anti-SH3BGR Antibody

Product Images

WB Suggested Anti-SH3BGR Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  WB Suggested Anti-SH3BGR Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: human LCL and mouse brains

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH3BGR antibody: synthetic peptide directed towards the N terminal of human SH3BGR. Synthetic peptide located within the following region: CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: SH3 domain binding glutamate rich protein
• Database Link:
  NP_031367
  Entrez Gene 50795 MouseEntrez Gene 6450 Human
  UniProt ID P55822
• Background: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.
• Synonyms: 21-GARP
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 83%