SH3BGR Rabbit Polyclonal Antibody

CAT#: TA338902

Rabbit Polyclonal Anti-SH3BGR Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SH3BGR"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SH3BGR antibody: synthetic peptide directed towards the N terminal of human SH3BGR. Synthetic peptide located within the following region: CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name SH3 domain binding glutamate rich protein
Background SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.
Synonyms 21-GARP
Note Immunogen Sequence Homology: Human: 100%; Horse: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.