PFKL Rabbit Polyclonal Antibody

CAT#: TA338906

Rabbit Polyclonal Anti-PFKL Antibody

Product Images

WB Suggested Anti-PFKL Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: human LCL and mouse brains

• 

  WB Suggested Anti-PFKL Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate.PFKL is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFKL antibody: synthetic peptide directed towards the middle region of human PFKL. Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: phosphofructokinase, liver type
• Database Link:
  NP_002617
  Entrez Gene 18641 MouseEntrez Gene 5211 Human
  UniProt ID P17858
• Background: This gene encodes the liver (L) subunit of an enzyme that catalyzes the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate, which is a key step in glucose metabolism (glycolysis). This enzyme is a tetramer that may be composed of different subunits encoded by distinct genes in different tissues. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
• Synonyms: ATP-PFK; PFK-B; PFK-L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%; Rabbit: 86%; Sheep: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway