CFAP298 Rabbit Polyclonal Antibody

CAT#: TA338943

Rabbit Polyclonal Anti-C21orf59 Antibody

Product Images

WB Suggested Anti-C21orf59 Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: human LCL and mouse brains

• 

  WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate.C21orf59 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C21orf59 antibody: synthetic peptide directed towards the N terminal of human C21orf59. Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: chromosome 21 open reading frame 59
• Database Link:
  NP_067077
  Entrez Gene 56683 Human
  UniProt ID P57076
• Background: This gene a protein plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. [provided by RefSeq, Nov 2013]
• Synonyms: C21orf48; CILD26; FBB18
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 92%