DUT Rabbit Polyclonal Antibody

CAT#: TA338974

Rabbit Polyclonal Anti-DUT Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat.DUT is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Heart

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DUT antibody: synthetic peptide directed towards the C terminal of human DUT. Synthetic peptide located within the following region: NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: deoxyuridine triphosphatase
• Database Link:
  NP_001020419
  Entrez Gene 1854 Human
  UniProt ID P33316
• Background: This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008]
• Synonyms: dUTPase
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Yeast: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pyrimidine metabolism