RRM2 Rabbit Polyclonal Antibody

CAT#: TA338976

Rabbit Polyclonal Anti-RRM2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RRM2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RRM2 antibody: synthetic peptide directed towards the N terminal of human RRM2. Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name ribonucleotide reductase regulatory subunit M2
Background This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]
Synonyms R2; RR2; RR2M
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Horse: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.