AK2 Rabbit Polyclonal Antibody

CAT#: TA338994

Rabbit Polyclonal Anti-AK2 Antibody

Product Images

WB Suggested Anti-AK2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate.There is BioGPS gene expression data showing that AK2 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AK2 antibody: synthetic peptide directed towards the N terminal of human AK2. Synthetic peptide located within the following region: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: adenylate kinase 2
• Database Link:
  NP_001616
  Entrez Gene 204 Human
  UniProt ID P54819
• Background: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. [provided by RefSeq, Nov 2010]
• Synonyms: ADK2; AK 2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 92%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism