Acid sphingomyelinase (SMPD1) Rabbit Polyclonal Antibody

CAT#: TA339053

Rabbit Polyclonal Anti-SMPD1 Antibody

Product Images

WB Suggested Anti-SMPD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: sphingomyelin phosphodiesterase 1
• Database Link:
  NP_000534
  Entrez Gene 6609 Human
  UniProt ID P17405
• Background: The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
• Synonyms: ASM; ASMASE; NPD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome, Metabolic pathways, Sphingolipid metabolism