N myc interactor (NMI) Rabbit Polyclonal Antibody

CAT#: TA339097

Rabbit Polyclonal Anti-NMI Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NMI antibody: synthetic peptide directed towards the N terminal of human NMI. Synthetic peptide located within the following region: ETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name N-myc and STAT interactor
Background NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
Synonyms N-myc (and STAT) interactor; N-myc-interactor; N-myc and STAT interactor; N-myc interactor
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 90%; Horse: 90%; Mouse: 90%; Guinea pig: 90%; Rabbit: 83%; Rat: 77%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.