PHD finger protein 6 (PHF6) Rabbit Polyclonal Antibody

CAT#: TA339156

Rabbit Polyclonal Anti-PHF6

Product Images

WB Suggested Anti-PHF6 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

• 

  Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6 Primary Dilution: 1: 1000 Secondary (goat anti-rabbit HRP) Dilution: 1: 1000

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF6 antibody: synthetic peptide directed towards the N terminal of human PHF6. Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: PHD finger protein 6
• Database Link:
  NP_115834
  Entrez Gene 70998 MouseEntrez Gene 84295 Human
  UniProt ID Q8IWS0
• Background: PHF6 is a member of the plant homeodomain (PHD)-like finger (PHF) family. PHF6 is a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation that localizes to the nucleolus. Mutations affecting the coding region
• Synonyms: BFLS; BORJ; CENP-31
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors