Kmt5b Rabbit Polyclonal Antibody

CAT#: TA339160

Rabbit Polyclonal Anti-Suv420h1


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Kmt5b"

Specifications

Product Data
Applications 10k-ChIP, WB
Recommended Dilution WB, ChIP
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name suppressor of variegation 4-20 homolog 1 (Drosophila)
Background Suv420h1 is a histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. It mainly functions in pericentric heterochromatin region
Synonyms C630029K18Rik; CGI-85; CGI85; KMT5B; MGC703; MGC21161; MGC118906; MGC118909; OTTHUMP00000197482; OTTHUMP00000197488; Suv4-20h1
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rabbit: 77%; Zebrafish: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.