Kmt5b Rabbit Polyclonal Antibody

CAT#: TA339160

Rabbit Polyclonal Anti-Suv420h1

Product Images

WB Suggested Anti-Suv420h1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Thymus

• 

  Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region and HCT116 Cells

• 

  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Specifications

Product Data

• Applications: 10k-ChIP, WB
• Recommended Dilution: WB, ChIP
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: suppressor of variegation 4-20 homolog 1 (Drosophila)
• Database Link:
  NP_001161356
  Entrez Gene 51111 HumanEntrez Gene 225888 Mouse
  UniProt ID Q3U8K7
• Background: Suv420h1 is a histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. It mainly functions in pericentric heterochromatin region
• Synonyms: C630029K18Rik; CGI-85; CGI85; KMT5B; MGC703; MGC21161; MGC118906; MGC118909; OTTHUMP00000197482; OTTHUMP00000197488; Suv4-20h1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rabbit: 77%; Zebrafish: 77%