Antibodies

View as table Download

Rabbit Polyclonal Anti-SUV420H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR

Rabbit Polyclonal Anti-SUV420H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUV420H1 Antibody: synthetic peptide directed towards the C terminal of human SUV420H1. Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR

Rabbit Polyclonal SUV420h1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 100-150) [UniProt Q4FZB7]

Rabbit Polyclonal SUV420h1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SUV420h1 protein (between residues 450-500) [UniProt Q4FZB7]

Rabbit Polyclonal Anti-SUV420H1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV420H1 antibody: synthetic peptide directed towards the middle region of human SUV420H1. Synthetic peptide located within the following region: PVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNAS

Rabbit Polyclonal Anti-Suv420h1

Applications 10k-ChIP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC

SUV420H1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3).
Modifications Unmodified