Troponin I fast skeletal muscle (TNNI2) Rabbit Polyclonal Antibody

CAT#: TA339170

Rabbit Polyclonal Anti-TNNI2

Product Images

WB Suggested Anti-TNNI2 Antibody Titration: 1.25 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNNI2 antibody: synthetic peptide directed towards the N terminal of human TNNI2. Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: troponin I2, fast skeletal type
• Database Link:
  NP_003273
  Entrez Gene 7136 Human
  UniProt ID P48788
• Background: Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
• Synonyms: AMCD2B; DA2B; FSSV; fsTnI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 75%