MLX Rabbit Polyclonal Antibody

CAT#: TA339232

Rabbit Polyclonal Anti-MLX

Product Images

WB Suggested Anti-MLX Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate. MLX is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Host: Rabbit; Target Name: MLX; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0 ug/ml MLX is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLX antibody: synthetic peptide directed towards the middle region of human MLX. Synthetic peptide located within the following region: EVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: MLX, MAX dimerization protein
• Database Link:
  NP_733752
  Entrez Gene 6945 Human
  UniProt ID Q9UH92
• Background: MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. MLX may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4.The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Synonyms: bHLHd13; MAD7; MXD7; TCFL4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors