IFT172 Rabbit Polyclonal Antibody

CAT#: TA339236

Rabbit Polyclonal Anti-IFT172

Product Images

WB Suggested Anti-IFT172 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFT172 antibody: synthetic peptide directed towards the N terminal of human IFT172. Synthetic peptide located within the following region: VKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 197 kDa
• Gene Name: intraflagellar transport 172
• Database Link:
  NP_056477
  Entrez Gene 26160 Human
  UniProt ID Q9UG01
• Background: IFT172 is required for the maintenance and formation of cilia. IT plays an indirect role in hedgehog (Hh) signaling, cilia being required for all activity of the hedgehog pathway.
• Synonyms: BBS20; NPHP17; osm-1; RP71; SLB; SRTD10; wim
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%