Rab9 (RAB9A) Rabbit Polyclonal Antibody

CAT#: TA339266

Rabbit Polyclonal Anti-RAB9A Antibody

Product Images

WB Suggested Anti-RAB9A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

• 

  RAB9A antibody - middle region validated by WB using 1. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); 3. Human Cervical Cancer Cell transfected with mouse Rab9A-GFP (15ug) at 1: 1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Monkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RAB9A, member RAS oncogene family
• Database Link:
  NP_004242
  Entrez Gene 9367 Human
  UniProt ID P51151
• Background: Involved in the transport of proteins between the endosomes and the trans Golgi network.
• Synonyms: RAB9
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome