Rab9 (RAB9A) Rabbit Polyclonal Antibody

CAT#: TA339267

Rabbit Polyclonal Anti-RAB9A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAB9A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Monkey
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name RAB9A, member RAS oncogene family
Background Involved in the transport of proteins between the endosomes and the trans Golgi network.
Synonyms RAB9
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.