Ubiquitin D (UBD) Rabbit Polyclonal Antibody

CAT#: TA339297

Rabbit Polyclonal Anti-UBD Antibody

Product Images

WB Suggested Anti-UBD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate.UBD is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBD antibody: synthetic peptide directed towards the N terminal of human UBD. Synthetic peptide located within the following region: RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: ubiquitin D
• Database Link:
  NP_006389
  Entrez Gene 10537 Human
  UniProt ID O15205
• Background: UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.
• Synonyms: FAT10; GABBR1; UBD-3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome