PFAS Rabbit Polyclonal Antibody

CAT#: TA339309

Rabbit Polyclonal Anti-PFAS Antibody

Product Images

PFAS antibody - N-terminal region validated by WB using 1. Human Skin Fibroblasts (100ug); 2. HEK273 cells (20ug); 3. HeLa skin cells (20ug) at 1: 2, 000.

• 

  WB Suggested Anti-PFAS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysatePFAS is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS. Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 145 kDa
• Gene Name: phosphoribosylformylglycinamidine synthase
• Database Link:
  NP_036525
  Entrez Gene 5198 Human
  UniProt ID O15067
• Background: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. [provided by RefSeq, Jul 2008]
• Synonyms: FGAMS; FGAR-AT; FGARAT; PURL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Rabbit: 79%

Reference Data

• Protein Pathways: Metabolic pathways, Purine metabolism