HURP (DLGAP5) Rabbit Polyclonal Antibody

CAT#: TA339316

Rabbit Polyclonal Anti-DLG7 Antibody

Product Images

WB Suggested Anti-DLG7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLG7 antibody: synthetic peptide directed towards the N terminal of human DLG7. Synthetic peptide located within the following region: EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: DLG associated protein 5
• Database Link:
  NP_055565
  Entrez Gene 9787 Human
  UniProt ID Q15398
• Background: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.
• Synonyms: DLG7; HURP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome