NUSAP1 Rabbit Polyclonal Antibody

CAT#: TA339336

Rabbit Polyclonal Anti-NUSAP1 Antibody

Product Images

WB Suggested Anti-NUSAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate.NUSAP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the C terminal of human NUSAP1. Synthetic peptide located within the following region: LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: nucleolar and spindle associated protein 1
• Database Link:
  NP_057443
  Entrez Gene 51203 Human
  UniProt ID Q9BXS6
• Background: NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]). [supplied by OMIM, Jun 2009]. Transcript Variant: This variant (7) uses an alternate in-frame splice site in the 5' coding region, compared to variant 1, resulting in an isoform (7) that is 1 aa shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC012887.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: ANKT; BM037; LNP; NUSAP; PRO0310p1; Q0310; SAPL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 86%