NUSAP1 Rabbit Polyclonal Antibody

CAT#: TA339347

Rabbit Polyclonal Anti-NUSAP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NUSAP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the middle region of human NUSAP1. Synthetic peptide located within the following region: AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name nucleolar and spindle associated protein 1
Background NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]). [supplied by OMIM, Jun 2009]. Transcript Variant: This variant (7) uses an alternate in-frame splice site in the 5' coding region, compared to variant 1, resulting in an isoform (7) that is 1 aa shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC012887.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms ANKT; BM037; LNP; NUSAP; PRO0310p1; Q0310; SAPL
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.