PSF1 (GINS1) Rabbit Polyclonal Antibody

CAT#: TA339351

Rabbit Polyclonal Anti-GINS1 Antibody

Product Images

WB Suggested Anti-GINS1 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate.GINS1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GINS1 antibody: synthetic peptide directed towards the N terminal of human GINS1. Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: GINS complex subunit 1
• Database Link:
  NP_066545
  Entrez Gene 9837 Human
  UniProt ID Q14691
• Background: The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: D80008.1, BC012542.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025092 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: PSF1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 86%