PEX11A Rabbit Polyclonal Antibody

CAT#: TA339384

Rabbit Polyclonal Anti-PEX11A Antibody

Product Images

WB Suggested Anti-PEX11A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PEX11A antibody: synthetic peptide directed towards the middle region of human PEX11A. Synthetic peptide located within the following region: MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: peroxisomal biogenesis factor 11 alpha
• Database Link:
  NP_003838
  Entrez Gene 8800 Human
  UniProt ID O75192
• Background: This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintenance and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]
• Synonyms: hsPEX11p; PEX11-ALPHA; PMP28
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Bovine: 79%; Pig: 77%

Reference Data

• Protein Families: Transmembrane