IL1RL2 Rabbit Polyclonal Antibody

CAT#: TA339385

Rabbit Polyclonal Anti-IL1RL2 Antibody

Product Images

WB Suggested Anti-IL1RL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL1RL2 antibody: synthetic peptide directed towards the N terminal of human IL1RL2. Synthetic peptide located within the following region: HVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: interleukin 1 receptor like 2
• Database Link:
  NP_003845
  Entrez Gene 8808 Human
  UniProt ID Q9HB29
• Background: The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq, Jul 2008]
• Synonyms: IL-1Rrp2; IL-36R; IL1R-rp2; IL1RRP2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Dog: 86%; Horse: 86%; Rabbit: 86%; Bovine: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane