Germany
Japan
United Kingdom
China
FCGRT Rabbit Polyclonal Antibody
Product Images
Other products for "FCGRT"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FCGRT antibody: synthetic peptide directed towards the N terminal of human FCGRT. Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 40 kDa |
| Gene Name | Fc fragment of IgG receptor and transporter |
| Database Link | |
| Background | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
| Synonyms | alpha-chain; FCRN |
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Mouse: 79%; Sheep: 79%; Bovine: 79% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.