BTBD15 (ZBTB44) Rabbit Polyclonal Antibody

CAT#: TA339465

Rabbit Polyclonal Anti-ZBTB44 Antibody

Product Images

WB Suggested Anti-ZBTB44 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44. Synthetic peptide located within the following region: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRNQPVDSSLAFP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: zinc finger and BTB domain containing 44
• Database Link:
  NP_054874
  Entrez Gene 29068 Human
  UniProt ID Q8NCP5
• Background: May be involved in transcriptional regulation.
• Synonyms: BTBD15; HSPC063; ZNF851
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Rat: 92%; Bovine: 86%