L3MBTL1 Rabbit Polyclonal Antibody

CAT#: TA339478

Rabbit Polyclonal Anti-L3MBTL Antibody

Product Images

WB Suggested Anti-L3MBTL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that L3MBTL1 is expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-L3MBTL antibody: synthetic peptide directed towards the N terminal of human L3MBTL. Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: l(3)mbt-like 1 (Drosophila)
• Database Link:
  NP_056293
  Entrez Gene 26013 Human
  UniProt ID Q9Y468
• Background: This gene represents a polycomb group gene. The encoded protein functions to regulate gene activity, likely via chromatin modification. The encoded protein may also be necessary for mitosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Sep 2010]
• Synonyms: dJ138B7.3; H-L(3)MBT; L3MBTL; ZC2HC3
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors