VGLL1 Rabbit Polyclonal Antibody

CAT#: TA339486

Rabbit Polyclonal Anti-VGLL1 Antibody

Product Images

WB Suggested Anti-VGLL1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the N terminal of human VGLL1. Synthetic peptide located within the following region: LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: vestigial like family member 1
• Database Link:
  NP_057351
  Entrez Gene 51442 Human
  UniProt ID Q99990
• Background: The protein encoded by this gene binds proteins of the TEA domain family of transcription factors (TEFs) through the Vg (vestigial) homology region found in its N-terminus. It may thus function as a specific coactivator for the mammalian TEFs. [provided by RefSeq, Sep 2009]
• Synonyms: TDU; VGL1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%

Reference Data

• Protein Families: Transcription Factors