NR0B2 Rabbit Polyclonal Antibody

CAT#: TA339536

Rabbit Polyclonal Anti-NR0B2 Antibody

Product Images

WB Suggested Anti-NR0B2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: VQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: nuclear receptor subfamily 0 group B member 2
• Database Link:
  NP_068804
  Entrez Gene 8431 Human
  UniProt ID Q15466
• Background: The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. [provided by RefSeq, Jul 2008]
• Synonyms: SHP; SHP1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Horse: 86%; Bovine: 86%; Dog: 85%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors