HSD3B7 Rabbit Polyclonal Antibody

CAT#: TA339548

Rabbit Polyclonal Anti-HSD3B7 Antibody

Product Images

WB Suggested Anti-HSD3B7 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSD3B7 antibody: synthetic peptide directed towards the middle region of human HSD3B7. Synthetic peptide located within the following region: QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
• Database Link:
  NP_079469
  Entrez Gene 80270 Human
  UniProt ID Q9H2F3
• Background: This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: CBAS1; PFIC4; SDR11E3
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Primary bile acid biosynthesis