TMEM163 Rabbit Polyclonal Antibody

CAT#: TA339569

Rabbit Polyclonal Anti-TMEM163 Antibody

Product Images

WB Suggested Anti-TMEM163 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM163 antibody: synthetic peptide directed towards the middle region of human TMEM163. Synthetic peptide located within the following region: AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: transmembrane protein 163
• Database Link:
  NP_112185
  Entrez Gene 81615 Human
  UniProt ID Q8TC26
• Background: The function of this protein remains unknown.
• Synonyms: DC29; SV31
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane