USP30 Rabbit Polyclonal Antibody

CAT#: TA339620

Rabbit Polyclonal Anti-USP30 Antibody

Product Images

WB Suggested Anti-USP30 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: THP-1 cell lysate

• 

  USP30 antibody - middle region validated by WB using Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP30 antibody: synthetic peptide directed towards the middle region of human USP30. Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: ubiquitin specific peptidase 30
• Database Link:
  NP_116052
  Entrez Gene 84749 Human
  UniProt ID Q70CQ3
• Background: USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
• Synonyms: FLJ40511; MGC10702
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Protease, Transmembrane